PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G096100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 276aa    MW: 31531.1 Da    PI: 9.8783
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G096100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.91e-19131184356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        ++ ++tkeq  +Le+ F+++++++ ++++ L+kkl+L+ rqV vWFqNrRa+ k
  Aqcoe5G096100.1.p 131 RKLRLTKEQAAVLEDNFKEHNTLNPKAKQALSKKLNLSPRQVEVWFQNRRARIK 184
                        66789***********************************************87 PP

2HD-ZIP_I/II119.32.1e-38130218190
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                        ++k+rl+keq+++LE++F+e+++L+p+ K++l+++L+l+prqv+vWFqnrRAR+k+kq+E+dye+Lk++++alk+en++L+ke ++L+ +
  Aqcoe5G096100.1.p 130 KRKLRLTKEQAAVLEDNFKEHNTLNPKAKQALSKKLNLSPRQVEVWFQNRRARIKMKQTEVDYEYLKKCCEALKDENKKLQKELRDLK-A 218
                        58************************************************************************************99.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.892126186IPR001356Homeobox domain
SMARTSM003891.2E-15128190IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.4E-18128189IPR009057Homeodomain-like
SuperFamilySSF466891.88E-18129195IPR009057Homeodomain-like
PfamPF000464.6E-17130184IPR001356Homeobox domain
CDDcd000861.74E-15130184No hitNo description
PROSITE patternPS000270161184IPR017970Homeobox, conserved site
PfamPF021836.3E-10186219IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.6E-19186229IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MFHNMDLQEF CDISLDLGLG SKRKSENEPV QFDVHHKKTC LKFNTGLFSI PSTTTSTSSE  60
PSLTLGLSEV SKNMCEGSTK VHTKAFPYKD VAFFSETRVK KVRDLGNEGM EMEKGCSRVV  120
SDDVEEGSGK RKLRLTKEQA AVLEDNFKEH NTLNPKAKQA LSKKLNLSPR QVEVWFQNRR  180
ARIKMKQTEV DYEYLKKCCE ALKDENKKLQ KELRDLKAIK VTPQALYRHL QATTLFVCPH  240
VVLDSSTHPP RDHITRRRKS QFYKPLNHHH PSATG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1178186RRARIKMKQ
2254259TRRRKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010245638.15e-73PREDICTED: homeobox-leucine zipper protein HAT22-like
TrEMBLA5B6265e-71A5B626_VITVI; Putative uncharacterized protein
STRINGVIT_00s0732g00010.t011e-70(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-54HD-ZIP family protein